PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_17679_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family ERF
Protein Properties Length: 197aa    MW: 21492.9 Da    PI: 5.1446
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_17679_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP238.43e-12831201655
                                   AP2  16 vAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 
                                           +AeIrdp +ng  +r++lg+f tae+Aa a+++a+ +++g
  cra_locus_17679_iso_1_len_1021_ver_3  83 AAEIRDPAKNG--ARVWLGTFETAEDAALAYDRAAYRMRG 120
                                           69*****9987..*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5103218.55864128IPR001471AP2/ERF domain
SuperFamilySSF541717.19E-1778130IPR016177DNA-binding domain
Gene3DG3DSA:3.30.730.105.3E-2379128IPR001471AP2/ERF domain
CDDcd000181.52E-2180128No hitNo description
SMARTSM003802.2E-2280134IPR001471AP2/ERF domain
PfamPF008471.6E-684120IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0009864Biological Processinduced systemic resistance, jasmonic acid mediated signaling pathway
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051301Biological Processcell division
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MYENGDFDAD LALLDSIRRH LLGESLSESP GTFSGESPTG MYGGSGKDSE EQMLIYSFLN  60
EATTITAVKM EPGSEKAAVG KIAAEIRDPA KNGARVWLGT FETAEDAALA YDRAAYRMRG  120
SRALLNFPLR INSGEPEPVR ITSKRSNSNS NSSTSSPSNS PSLKRKKAIK VAEPPVLVVE  180
QDTEHRGYGE QRLFSEW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3gcc_A5e-32801351570ATERF1
2gcc_A5e-32801351570ATERF1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00548DAPTransfer from AT5G47220Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003549934.11e-46PREDICTED: ethylene-responsive transcription factor 1A-like
RefseqXP_007039732.12e-46AP2/ERF domain-containing transcription factor, putative
SwissprotO803388e-44EF101_ARATH; Ethylene-responsive transcription factor 2
TrEMBLA0A068UQX43e-55A0A068UQX4_COFCA; Uncharacterized protein
STRINGGLYMA17G15480.14e-46(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21241165